CPLX1_MOUSE P63040
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63040
Recommended name：Complexin-1
EC number：
Alternative names：(921-S) (Complexin I) (CPX I) (Synaphin-2)
Cleaved into：
GeneID：12889
Gene names (primary )：Cplx1
Gene names (synonym )：
Gene names (ORF )：
Length：134
Mass：15122
Sequence：MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEEDESILDTVIKYLPGPLQDMFKK
Tissue specificity：Nervous system, and pancreatic islet cells. Present in many brain regions, including hippocampus and cerebellum. In the retina, present at conventional amacrine cell synapses (at protein level). {ECO:0000269|PubMed:15126625, ECO:0000269|PubMed:15911881, ECO:0000269|PubMed:7635198}.
Induction：
Developmental stage：In the brain, expression starts at P6 and increases to reach a plateau at P20. {ECO:0000269|PubMed:15911881}.
Protein families：Complexin/synaphin family