CRIP2_MOUSE   Q9DCT8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCT8

Recommended name:Cysteine-rich protein 2

EC number:

Alternative names:(CRP-2) (Heart LIM protein)

Cleaved into:

GeneID:68337

Gene names  (primary ):Crip2

Gene names  (synonym ):Crp2 Hlp

Gene names  (ORF ):

Length:208

Mass:22727

Sequence:MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCNKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPQTEAPQVTGPIEVPVVRTEERKTSGPPKGPSKASSVTTFTGEPNMCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCSKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDKDPEGTVQP

Tissue specificity:

Induction:

Developmental stage:In the embryo, its expression is primarily restricted to the developing heart. In situ hybridization showed expression at 7.75 dpc in the paired heart-forming primordia prior to linear heart-tube formation. At 8.5 dpc, strong expression is detected in the heart, with equal expression in both heart chambers. Expression is detected in both myocardium and endocardium, and in vascular endothelium. Later in fetal development low levels of expression is detected outside the heart, including dorsal root ganglia and the spinal cord. In the adult, it is expressed at highest levels in the heart, and at lower levels in the brain, skeletal muscle and aorta. {ECO:0000269|PubMed:12128222}.

Protein families:


   💬 WhatsApp