MK_MOUSE P12025
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12025
Recommended name：Midkine
EC number：
Alternative names：(MK) (Retanoic acid-responsive protein) (Retinoic acid-induced differentiation factor)
Cleaved into：
GeneID：17242
Gene names (primary )：Mdk
Gene names (synonym )：Mk
Gene names (ORF )：
Length：140
Mass：15434
Sequence：MQHRGFFLLALLALLVVTSAVAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Tissue specificity：Expressed in the follicular epithelium and granulosa cells of the ovary. {ECO:0000269|PubMed:17121547}.
Induction：By retinoic acid (PubMed:2345177). Induced after tissue damage (PubMed:17015789, PubMed:19060126). Induced by inflammatory cells, in particular, CD4(+) T cells under inflammatory conditions (PubMed:22323540). Induced during the early and intermediate phase of fracture repair (PubMed:25551381). {ECO:0000269|PubMed:17015789, ECO:0000269|PubMed:19060126, ECO:0000269|PubMed:22323540, ECO:0000269|PubMed:2345177, ECO:0000269|PubMed:25551381}.
Developmental stage：Is expressed temporarily during the early stages of retinoic acid-induced differentiation of embryonal carcinoma cells and during the mid-gestation period of mouse embryogenesis. In late embryos and in adults expression is restricted to the kidney.
Protein families：Pleiotrophin family