CAPZB_MOUSE P47757
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47757
Recommended name:F-actin-capping protein subunit beta
EC number:
Alternative names:(CapZ beta)
Cleaved into:
GeneID:12345
Gene names (primary ):Capzb
Gene names (synonym ):Cappb1
Gene names (ORF ):
Length:277
Mass:31345
Sequence:MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSLDAIPDNHKFKQLQRELSQVLTQRQVYIQPDN
Tissue specificity:Isoform 3 is testis-specific and is present in round spermatids, but not in pachytene spermatocytes or Sertoli cells. {ECO:0000269|PubMed:19341723}.
Induction:
Developmental stage:Isoform 3 is first detected in testis 22 days after birth, coinciding with the first wave of round spermatid development. It is also detected on 30 and 60 days after birth. {ECO:0000269|PubMed:19341723}.
Protein families:F-actin-capping protein beta subunit family