PHB_MOUSE P67778
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P67778
Recommended name：Prohibitin
EC number：
Alternative names：(B-cell receptor-associated protein 32) (BAP 32)
Cleaved into：
GeneID：18673
Gene names (primary )：Phb
Gene names (synonym )：
Gene names (ORF )：
Length：272
Mass：29820
Sequence：MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Tissue specificity：Widely expressed in different tissues. {ECO:0000269|PubMed:8070406}.
Induction：In B cells, expression is increased by CD40 engagement (at protein level). {ECO:0000269|PubMed:23241883}.
Developmental stage：Throughout gestation, highly expressed in brown fat, heart, liver, developing renal tubules and neurons, and detected at lower levels in tissues such as lung and exocrine pancreas. {ECO:0000269|PubMed:11302691}.
Protein families：Prohibitin family