CITE4_MOUSE Q9WUL8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WUL8
Recommended name：Cbp/p300-interacting transactivator 4
EC number：
Alternative names：(MSG1-related protein 2) (MRG-2)
Cleaved into：
GeneID：56222
Gene names (primary )：Cited4
Gene names (synonym )：Mrg2
Gene names (ORF )：
Length：182
Mass：18398
Sequence：MADHLMLAEGYCLLQVPPHTHGPHAPRTLQPYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPAAAGGPSPLQPAPGAAASLPPPPPPPALGCMDTELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPAAGSVSC
Tissue specificity：Strongly expressed in heart, spleen and testis, and weakly in liver and kidney. {ECO:0000269|PubMed:12504852}.
Induction：
Developmental stage：Undetectable in nulliparous mammary glands but strongly expressed in 11.5 dpc pregnant mammary glands. Strong expression continued until the end of the lactacting stage and then rapidly diminished during the weaning stage. {ECO:0000269|PubMed:12504852}.
Protein families：CITED family