TMLH_MOUSE Q91ZE0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91ZE0
Recommended name：Trimethyllysine dioxygenase, mitochondrial
EC number：EC 1.14.11.8
Alternative names：(Epsilon-trimethyllysine 2-oxoglutarate dioxygenase) (TML hydroxylase) (TML-alpha-ketoglutarate dioxygenase) (TML dioxygenase) (TMLD)
Cleaved into：
GeneID：192289
Gene names (primary )：Tmlhe
Gene names (synonym )：Tmlh
Gene names (ORF )：
Length：421
Mass：49610
Sequence：MWYHKLLHQQSRLRNLMKRGNIAQGLHLSNFKSLFSSSIHWCHTTSKSVNCTWHQHEDHLELQYAGTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTVHLDETMLFFTWPDGHVTRYDLDWLVKNSYEGQKQKVIQPRILWNSKLYQQAQVPSVDFQCFLETNEGLKKFLQNFLLYGIAFVENVPPTEEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAQQVLQKAPEEFELLSKVPLKHEYIENVGQCHNHMIGVGPILNIYPWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTTELRRPENELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARLLGLHA
Tissue specificity：
Induction：
Developmental stage：Present already at 9.0 dpc. At 10.5 dpc, expressed throughout the embryo. At 12.5 dpc, higher levels in the developing lung, liver and brain compared to other tissues. In the postnatal day 7 brain, high levels in the Purkinje cell layer of the cerebellum and in the hyppocampal areas of the dentate gyrus and CA1, CA2 and CA3 pyramidal cells. {ECO:0000269|PubMed:17408883}.
Protein families：Gamma-BBH/TMLD family