MKRN1_MOUSE Q9QXP6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXP6
Recommended name:E3 ubiquitin-protein ligase makorin-1
EC number:EC 2.3.2.27
Alternative names:(RING-type E3 ubiquitin transferase makorin-1)
Cleaved into:
GeneID:
Gene names (primary ):Mkrn1
Gene names (synonym ):
Gene names (ORF ):
Length:481
Mass:53008
Sequence:MAEAAAPGTTATTSGAGAAAAAVAAASLTSIPTVAAPSPGAGGGGGGSDGSGGGWTKQVTCRYFMHGVCKEGDNCRYSHDLSDSPYGVVCKYFQRGYCVYGDRCRYEHSKPLKQEEVTATDLSAKPSLAASSSLSSGVGSLAEMNSGEAESRNPSFPTVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEVPPQGSVTKEESEKEPTTVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPVDAAQRSQHIKSCIEAHEKDMELSFAVQRTKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRSHFWELIEERENNPFDNDEEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDFYDLDL
Tissue specificity:Highly expressed in embryo, in specific cell types of the central nervous system, in brain with the strongest levels of expression in the mantle layers and in testis. Moderate to low levels in somatic tissues. {ECO:0000269|PubMed:10843807, ECO:0000269|PubMed:12721631, ECO:0000269|PubMed:12971993}.
Induction:
Developmental stage:Not detected until 11 dpc. Restricted to developing central nervous system in 13 days embryos. {ECO:0000269|PubMed:10843807}.
Protein families: