PA2GF_MOUSE   Q9QZT4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZT4

Recommended name:Group IIF secretory phospholipase A2

EC number:EC 3.1.1.4

Alternative names:(GIIF sPLA2) (sPLA2-IIF) (Phosphatidylcholine 2-acylhydrolase 2F)

Cleaved into:

GeneID:26971

Gene names  (primary ):Pla2g2f

Gene names  (synonym ):

Gene names  (ORF ):

Length:168

Mass:18880

Sequence:MKKFFAIAVLAGSVVTTAHSSLLNLKSMVEAITHRNSILSFVGYGCYCGLGGRGHPMDEVDWCCHAHDCCYEKLFEQGCRPYVDHYDHRIENGTMIVCTELNETECDKQTCECDKSLTLCLKDHPYRNKYRGYFNVYCQGPTPNCSIYDPYPEEVTCGHGLPATPVST

Tissue specificity:Strongly expressed in testis. {ECO:0000269|PubMed:10531313}.

Induction:Strongly up-regulated by lipopolysaccharide (LPS) in brain, heart, liver, colon and testis. {ECO:0000269|PubMed:11877435}.

Developmental stage:Strongly expressed during embryogenesis. {ECO:0000269|PubMed:10531313}.

Protein families:Phospholipase A2 family


   💬 WhatsApp