GIMA3_MOUSE Q99MI6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99MI6
Recommended name：GTPase IMAP family member 3
EC number：
Alternative names：(Immunity-associated nucleotide 4 protein) (IAN-4)
Cleaved into：
GeneID：83408
Gene names (primary )：Gimap3
Gene names (synonym )：Ian4
Gene names (ORF )：
Length：301
Mass：34179
Sequence：METLQNVVTGGKKGGCTSGSRPLRILLVGKSGCGKSATGNSLLRRPAFESRLRGQSVTRTSQAETGTWEGRSILVVDTPPIFESKAQNQDMDKDIGDCYLLCAPGPHVLLLVTQLGRFTAEDVMAVRMVKEVFGVGVMRHMIVLFTRKEDLAEKSLEEFVTHTDNRSLRSLVQECGRRYCAFNNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDLFLHAETLLREGYSVHQEAYRCYLAKVRQEVEKQRWELEEQEGSWVLKVLPIGKKLEVLHSDFCWYLVLAILIFFVFFFLLFYV
Tissue specificity：Expressed in thymus (in thymocytes), spleen (in splenocytes), lymph node and, at lower levels, in lung (PubMed:16509771, PubMed:25808953). Highly expressed in T lymphocytes (PubMed:16509771). {ECO:0000269|PubMed:16509771, ECO:0000269|PubMed:25808953}.
Induction：By BCR-ABL oncogene.
Developmental stage：Up-regulated upon the maturation of CD4/CD8 double-positive to CD4 single-positive thymocytes. {ECO:0000269|PubMed:16509771}.
Protein families：TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, IAN subfamily