H2AX_MOUSE P27661
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P27661
Recommended name:Histone H2AX
EC number:
Alternative names:(H2a/x) (Histone H2A.X)
Cleaved into:
GeneID:15270
Gene names (primary ):H2ax
Gene names (synonym ):H2a.x H2afx Hist5-2ax
Gene names (ORF ):
Length:143
Mass:15143
Sequence:MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKSSATVGPKAPAVGKKASQASQEY
Tissue specificity:Most abundant in testis, thymus and spleen. {ECO:0000269|PubMed:11242108}.
Induction:
Developmental stage:Synthesized in G1 as well as in S-phase.
Protein families:Histone H2A family