MEIS3_MOUSE   P97368


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97368

Recommended name:Homeobox protein Meis3

EC number:

Alternative names:(Meis1-related protein 2)

Cleaved into:

GeneID:17537

Gene names  (primary ):Meis3

Gene names  (synonym ):Mrg2

Gene names  (ORF ):

Length:378

Mass:41726

Sequence:MARRYDELRHYPGITEHTTALASFSEAAPSVPRAPGPYTPHRPPQLQAPGLDSDSLKREKDDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIRSERPLFSSNPELDNLMVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGSCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQPMAGFTETQPQVTVRTPGSMGMNLNLEGEWHYL

Tissue specificity:Expressed at high levels in the brain. Significant expression also observed in the heart, spleen and lung. Expressed in pancreatic islets (beta-cells and non-beta-cells) (PubMed:21059917). {ECO:0000269|PubMed:21059917}.

Induction:

Developmental stage:Not expressed until 11 days in embryonic development.

Protein families:TALE/MEIS homeobox family


   💬 WhatsApp