MZB1_MOUSE Q9D8I1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D8I1
Recommended name：Marginal zone B- and B1-cell-specific protein
EC number：
Alternative names：(Plasma cell-induced resident endoplasmic reticulum protein) (Plasma cell-induced resident ER protein) (pERp1) (Proapoptotic caspase adapter protein)
Cleaved into：
GeneID：69816
Gene names (primary )：Mzb1
Gene names (synonym )：Pacap
Gene names (ORF )：
Length：188
Mass：20580
Sequence：MRLPLPLLLLFGCRAILGSAGDRVSLSASAPTLDDEEKYSAHMPAHLRCDACRAVAFQMGQRLAKAEAKSHTPDASGLQELSESTYTDVLDQTCSQNWQSYGVHEVNQMKRLTGPGLSKGPEPRISVMISGGPWPNRLSKTCFHYLGEFGEDQIYEAYRQGQANLEALLCGGTHGPCSQEILAQREEL
Tissue specificity：Expressed predominantly in the spleen and lymph nodes. Abundantly expressed in marginal zone B and B1 cells. High expression in mesenteric adipose tissue (MAT). Expressed also in pancreas, perigonadal adipose tissue (PAT), uterus, subcutaneous adipose tissue, heart, muscle, ovary and liver. Very low expression is detected in brown adipose tissue. In PAT, significantly higher expression in stromal-vascular cell than in adipocytes. Expressed in macrophage RAW 264.7 cell line. Down-regulated in For-knockout female MAT at 5 months (obese state) followed by steep up-regulation at 9 months (prediabetic condition) when mutants progress towards the metabolic syndrome. {ECO:0000269|PubMed:19805154, ECO:0000269|PubMed:21093319, ECO:0000269|PubMed:21688198}.
Induction：
Developmental stage：Up-regulated during plasma cell differentiation. {ECO:0000269|PubMed:19805154, ECO:0000269|PubMed:19805157}.
Protein families：MZB1 family