GNA1_MOUSE   Q9JK38


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JK38

Recommended name:Glucosamine 6-phosphate N-acetyltransferase

EC number:EC 2.3.1.4

Alternative names:(Phosphoglucosamine acetylase) (Phosphoglucosamine transacetylase) (Protein EMeg32)

Cleaved into:

GeneID:54342

Gene names  (primary ):Gnpnat1

Gene names  (synonym ):Gna1

Gene names  (ORF ):

Length:184

Mass:20791

Sequence:MKPDETPMFDPSLLKEVDWSQNTAIFSPAISPTHPGEGLVLRPLCTADLNKGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFDYTVSEENYMCRRFLK

Tissue specificity:Ubiquitous. Shows a strong differential expression pattern in adult hematopoietic precursor cells. {ECO:0000269|PubMed:10777580}.

Induction:

Developmental stage:Widely expressed at early stages of embryonic development but is confined to bones, skin and the hematopoietic system at later developmental stages. {ECO:0000269|PubMed:10777580}.

Protein families:Acetyltransferase family, GNA1 subfamily