EDF1_MOUSE   Q9JMG1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JMG1

Recommended name:Endothelial differentiation-related factor 1

EC number:

Alternative names:(EDF-1) (Multiprotein-bridging factor 1) (MBF1)

Cleaved into:

GeneID:59022

Gene names  (primary ):Edf1

Gene names  (synonym ):

Gene names  (ORF ):

Length:148

Mass:16369

Sequence:MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQRGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPKAK

Tissue specificity:Expressed in brain, liver, kidney and heart (at protein level). Also expressed in testis. {ECO:0000269|PubMed:11587857}.

Induction:

Developmental stage:Very highly expressed seven days after implantation, when gastrulation and neurulation occurs. Expression decreases 11 days after implantation, when organogenesis is being completed, and remains rather low up to late developmental stages. {ECO:0000269|PubMed:11587857}.

Protein families: