VRK3_MOUSE   Q8K3G5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K3G5

Recommended name:Inactive serine/threonine-protein kinase VRK3

EC number:

Alternative names:(Serine/threonine-protein pseudokinase VRK3) (Vaccinia-related kinase 3)

Cleaved into:

GeneID:101568

Gene names  (primary ):Vrk3

Gene names  (synonym ):

Gene names  (ORF ):

Length:453

Mass:50830

Sequence:MISFCPVCGKSVKVSFKFCPYCGKALPVEEDGGTQSAVTPHVSSVPGSRRDLNSSFETSPKKVKCSHTVTSLPLSRHSDCDSSGSDNTLTSPDRATGTRSRPLTPKGSPLSNRQSPQTLKRTRVTTSLQALATGTELTDQNGKHWTLGALQIRDDQGILYEAEPTSAVPSESRTQKWRFSLKLDSKDGRLFNEQNFFQRVAKPLQVNKWKKQFLLPLLAIPTCIGFGIHQDKYRFLVFPSLGRSLQSALDDNPKHVVSERCVLQVACRLLDALEYLHENEYVHGNLTAENVFVNPEDLSQVTLVGYGFTYRYCPGGKHVAYKEGSRSPHDGDLEFISMDLHKGCGPSRRSDLQTLGYCMLKWLYGSLPWTNCLPNTEKITRQKQKYLDSPERLVGLCGRWNKASETLREYLKVVMALNYEEKPPYATLRNSLEALLQDMRVSPYDPLDLQMVP

Tissue specificity:Expressed in liver, kidney, muscle, thymus, and bone marrow. Weakly expressed in spleen. {ECO:0000269|PubMed:12782311}.

Induction:

Developmental stage:Weakly expressed in embryo compared to VRK1 and VRK3. Expressed from 10.5 dpc to 13.5 dpc in developing liver and then decreases. It increases again from 17.5 dpc and remains thereafter. Highly expressed in hematopoietic embryonic tissues from 10.5 dpc to 14.5 dpc. Strongly expressed in the yolk-sac. {ECO:0000269|PubMed:12782311}.

Protein families:Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily


   💬 WhatsApp