MCP_MOUSE   O88174


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88174

Recommended name:Membrane cofactor protein

EC number:

Alternative names:(CD antigen CD46)

Cleaved into:

GeneID:17221

Gene names  (primary ):Cd46

Gene names  (synonym ):Mcp

Gene names  (ORF ):

Length:365

Mass:40881

Sequence:MTAAPLMPDSTHPCRRRKSYTFFWCSLGVYAEALLFLLSHLSDACELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAWIIALIVITSIVGVFILCLIVLRCFEHRKKTNVSAAR

Tissue specificity:Present only in testis (at protein level). {ECO:0000269|PubMed:12640142, ECO:0000269|PubMed:9461505, ECO:0000269|PubMed:9799332}.

Induction:

Developmental stage:Not expressed until 29 dpc. Expressed in parallel with synthesis of spermatids. {ECO:0000269|PubMed:9461505}.

Protein families:


   💬 WhatsApp