H2AL1_MOUSE Q5M8Q2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5M8Q2
Recommended name：Histone H2A-like 1
EC number：
Alternative names：(H2A.L.1) (H2AL1) (Histone H2Alike 1)
Cleaved into：
GeneID：100042922
Gene names (primary )：H2al1a; H2al1c; H2al1d; H2al1f; H2al1g; H2al1h; H2al1i
Gene names (synonym )：; ; ; ; ; ;
Gene names (ORF )：; ; ; ; ; ;
Length：105
Mass：12122
Sequence：MAKKMQRRRRQKRTRSQRGELPFSLVDRFLREEFHSSRLSSSALSFLTSVLEYLTSNILELAGEVAQTTGRKRIAPEDVRLVVQNNEQLRQLFKPGGTSVNEDDN
Tissue specificity：Testis-specific. {ECO:0000269|PubMed:17261847}.
Induction：
Developmental stage：Strongly enriched in step 12-16 spermatids and accumulate during late spermiogenesis, in condensing spermatids (PubMed:17261847). Remains present in mature spermatozoa isolated from epididymis (PubMed:17261847). Rapidly disappears from the paternal pericentric heterochromatin regions after sperm-egg fusion (PubMed:18703863). {ECO:0000269|PubMed:17261847, ECO:0000269|PubMed:18703863}.
Protein families：Histone H2A family