IGDC3_MOUSE Q8BQC3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BQC3
Recommended name：Immunoglobulin superfamily DCC subclass member 3
EC number：
Alternative names：(Putative neuronal cell adhesion molecule)
Cleaved into：
GeneID：19289
Gene names (primary )：Igdcc3
Gene names (synonym )：Punc
Gene names (ORF )：
Length：813
Mass：86460
Sequence：MAEPRTASPRRLPALRRPGFLPPLLPPPPPPLLLLLLLLPLPAPSLGLGHSAELAFSVEPNDDIANPGQPIVLGCKVEGTPPVQVSWRKNGAELPEGTHTTLLANGSLLIHHFRLEQGGSPSDEGDYECVAQNRFGLLVSRKARLQAATMSDFHVHPQAVTGEEGGVARFQCQIHGLPKPLITWEKNRVPIDTDDERYTLLPKGVLQITGLRAEDSGIFHCVASNIASVRVSHGARLTVSGSGSGTYKEPTILVGPENLTLTVHQTAVLECVATGNPRPIVSWSRLDGRPIGVEGIQVLGTGNLIISDVTVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQSISRPAGTTAMFTCQAQGEPPPHVTWLKNGQVLGAGGHVRLKNNNSTLSISGVGPEDEAIYQCVAENIAGSSQASARLTVLWAEGLPGPPRNVRAVSVSSTEVRVSWSEPLAHTKEIIGYVLHIRKAADSPKLEYQEAVSKSTFQHLVRDLEPSTAYSFYIKAYTPRGASLASVPTLASTLGEAPVPPPLSVRLLGSSSLQLLWKPWPRLAQHNGGFKLFYRPVSATSFTGPILLPGTVSSYNLSQLDPSTVYEVKLLAYNQHGDGNATVRFVSLKGASERTALTPPCDCRKEDVTNHTSTTGIVIGIHIGVTCIIFCVLFLLFGQRGRVLLCKDVENQLSPPQGPRSQRDPGILALNGLSRGEGGQLSRDEKPVDAKELEQLFPTAGSAAQPGSTPTDPAAPAPCEETQLSMVQLQGFNLVAGRTTEATSPCAGPGPVPAPQDIGPVPLSEGQTQPPAVAAPQ
Tissue specificity：Detected in cerebellum, kidney, heart, lung, skeletal muscle and spleen. {ECO:0000269|PubMed:9507132, ECO:0000269|PubMed:9922388}.
Induction：
Developmental stage：Strongly expressed in embryos from 9.5 dpc to 10.5 dpc. Expression is much lower at 11.5 dpc and virtually extinct at 15.5 dpc. Detected in neural tube and lateral mesoderm at 9.5 dpc. At 10.5 dpc detected in fore and hind limb buds and lateral plate mesoderm, throughout the neural tube, in mesencephalon and dorsal diencephalon. {ECO:0000269|PubMed:9507132}.
Protein families：Immunoglobulin superfamily, DCC family