VRK2_MOUSE Q8BN21
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BN21
Recommended name：Serine/threonine-protein kinase VRK2
EC number：EC 2.7.11.1
Alternative names：(Vaccinia-related kinase 2)
Cleaved into：
GeneID：69922
Gene names (primary )：Vrk2
Gene names (synonym )：
Gene names (ORF )：
Length：503
Mass：58119
Sequence：MAPRRKEKYKLPVPLPEGKILDDMEGNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVIKLEYQENGPLFSELKFYQRAAKRECIQKWIQQRKLDYLGIPVFYGFGLTDFKGRSYRFMVMERLGIDLQKLLDQNGGFKKLTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLDFTNPDRVYLADYGLSYRYCPNGNHKQYQEDPRKGHNGTIEFTSLDAHKGVAPSRRSDVEILGYCMLHWLFGKLPWEAKLDDPVAVQTAKTNLLDELPESVLKWAPSGSSCSELVKYLMYVHNLAYDDKPDYQKLKKILNPDGVPLGPLEFSTKVQSVHVRTPAQQKVDSPKATRKPANEFPAKFPKKVHRETRARQREEQEDSQPTMLQSRPAAPENSRTRKIHEYSDIFSEMQSLQQTPSYMSFQGSYCKPYLDCTRRDPIRKPRSLPRYRHTPTGNLGVTDLESSPRFWPAIFQLTLSEETKADVYYYGITIFCLLIFVFLALYFL
Tissue specificity：Expressed in liver, kidney and muscle. Weakly expressed in thymus, bone marrow and spleen. {ECO:0000269|PubMed:12782311}.
Induction：
Developmental stage：Weakly expressed in embryo compared to VRK1 and VRK3. Expressed from 10.5 dpc to 14 dpc in developing liver and then decreases. It increases again from 17.5 dpc and remains thereafter. Highly expressed in hematopoietic embryonic tissues from 10.5 dpc to 14.5 dpc. Weakly expressed in the yolk-sac. {ECO:0000269|PubMed:12782311}.
Protein families：Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily