LY6K_MOUSE   Q9CWP4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CWP4

Recommended name:Lymphocyte antigen 6K

EC number:

Alternative names:(Ly-6K)

Cleaved into:

GeneID:76486

Gene names  (primary ):Ly6k

Gene names  (synonym ):

Gene names  (ORF ):

Length:154

Mass:17134

Sequence:MAFLVALLVVLGLQLVQSNALTCHVCEAQNSYACSNPSQCPGEKKFCLLAVTRIFERFFYVSKQCTRRCPTPVVSPPSTNPPSEPKEFLIEKPMPFLFYKCCQWDSCNGEGPPTDQLLKEQPGKASGRRHRYIELLLTGFMVLTANGLSALCLL

Tissue specificity:Strongly expressed in testes and weakly expressed in the epididymis, ovary, and uterus (PubMed:20920470). Expressed in testicular germ cells (TGCs) (PubMed:24501175). Expressed in the testicular seminiferous tubules, in spermatocytes, spermatids, and testicular spermatozoa (PubMed:27005865). {ECO:0000269|PubMed:20920470, ECO:0000269|PubMed:24501175, ECO:0000269|PubMed:27005865}.

Induction:

Developmental stage:Weakly expressed in testes from 18 day postcoitus to 1 day postpartum (dpp), with a plateau starting around 8 dpp; and testicular expression shows two-peak expression at around 14 dpp and 24 dpp, then exhibits stable expression from 6-week after birth onward. {ECO:0000269|PubMed:20920470}.

Protein families: