ERMIN_MOUSE Q5EBJ4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5EBJ4
Recommended name：Ermin
EC number：
Alternative names：(Juxtanodin) (JN)
Cleaved into：
GeneID：77767
Gene names (primary )：Ermn
Gene names (synonym )：Kiaa1189
Gene names (ORF )：
Length：281
Mass：32148
Sequence：MTDTPETLSGTECNGDRPPENGQQPSSQTRQETTDADETQAYYKVEPSLEDLPAKENQEETGNTKGNILPKGPEDEKILNENPEENLFVVHQAIKDLSLQEISAEDMAFREGHPWKKIPPNSSNLEVSRQKERTAQQQLEQRGDASTTEIEWLGFQKSRPVDILHSKCDEEEEEEEEVWNEEINEEDVDECAEEEDEVRVIEFKRKHREGSPLKEESLAREDSPLGSPGSQPGTPDEQPVFGKKGDIARNSYSRYNTISYRKIRKGNTKQRIDEFESMMHL
Tissue specificity：Brain and spinal cord. Exclusively expressed by the oligodendrocytes. Appears at a late stage during myelination, and in the mature nerves, it is localized to the outer cytoplasmic lip of the myelin sheath and the paranodal loops. {ECO:0000269|PubMed:16421295}.
Induction：
Developmental stage：Weakly detectable in the first 3 postnatal days, but increases during the initial 2 weeks after birth. {ECO:0000269|PubMed:16421295}.
Protein families：