UBFL1_MOUSE   Q3USZ2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3USZ2

Recommended name:Upstream-binding factor 1-like protein 1

EC number:

Alternative names:(HMG-box preimplantation embryo-specific protein) (HMGPI)

Cleaved into:

GeneID:546118

Gene names  (primary ):Ubtfl1

Gene names  (synonym ):Hmgpi

Gene names  (ORF ):

Length:394

Mass:46131

Sequence:MTSLDNQGLWSEKDILKLLECMEHNIPSDDSREFKKSQADLNWSKVAFGLFSGEMCKQKWMEISYNLRKFRTLTELVQEAKFSFTKKTHKNKILTEHPDRPKRPLTAYLRFYKEQRAKYCQMYPKYSNAQLTKILAEKYRQLPAEIKQRYIMDFKKEKEDFQKKMRQFKKRHPVSGHPKKSVVPQSHPTKVPTKSQGDIKNVKSLVKTESPRTVSSDMKFQGEPRKPPMNAYHKFHQESWSSPELRHLSFRKRWVEISRRWHQVPENEKEHYSNQVKRLQKQYRVKLDLWLKRLSPEEYAAYKEAKATCGKRKNMSMSGGRSSKFGRTEQSSSEKGLQIKPGEVEELLDPGTDSSGTIQGHHDGAQSSRQDFTDDSEEDDSSTSSDSSSTDEDD

Tissue specificity:

Induction:

Developmental stage:Transcriptionally activated at the 2-cell stage, peaks at the 4-cell stage and then gradually decreased until the blastocyst stage. The protein is detected from the 4-cell stage until the blastocyst stage. In blastocysts, expressed both by inner cell mass and trophectodermal cells (at protein level). Not detected in post-implentation, neither in fetal, nor adult tissues. {ECO:0000269|PubMed:19915186}.

Protein families:


   💬 WhatsApp