HSPB7_RAT   Q9QUK5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QUK5

Recommended name:Heat shock protein beta-7

EC number:

Alternative names:Cardiovascular heat shock protein (cvHsp)

Cleaved into:

GeneID:

Gene names  (primary ):Hspb7

Gene names  (synonym ):Cvhsp

Gene names  (ORF ):

Length:90

Mass:9,804

Sequence:SSSSSSASRALPAQDPPMEKALSMFSEDFGSFMLPHSEPLTFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTSNNHIEVRAEKKP

Tissue specificity:Found in both cardiac and skeletal muscle.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp