T106A_RAT Q5BK83
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5BK83
Recommended name:Transmembrane protein 106A
EC number:
Alternative names:
Cleaved into:
GeneID:287722
Gene names (primary ):Tmem106a
Gene names (synonym ):
Gene names (ORF ):
Length:261
Mass:29,136
Sequence:MGKAFSQLTSQKDEDKSILPDNPAMASKAANYFSTGNRKPSHSCVPCEKAASTSFVTCPTCQGNGEIPQELEKQLVALIPYGDQRLKPRRTKLSVFLAVTICLLIFSLTIFFLYPRNIVVHPVGLNSSTVAFDETHVQLNMTNVLNITNSNFYPVTVTQLTAEVLHQTSVVGQVTSSLRLHIGPLASKQMPYEVASRILDENTYKICTWPKIRVHHILVNIQGALTCSYLTHPQQLPFESFEYVDCRENMSMPHLELPRPA
Tissue specificity:
Induction:
Developmental stage:
Protein families: