TM10A_RAT   Q4KLI2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4KLI2

Recommended name:tRNA methyltransferase 10 homolog A

EC number:EC:2.1.1.221

Alternative names:RNA (guanine-9-)-methyltransferase domain-containing protein 2 tRNA (guanine(9)-N(1))-methyltransferase TRMT10A

Cleaved into:

GeneID:295496

Gene names  (primary ):Trmt10a

Gene names  (synonym ):Rg9mtd2

Gene names  (ORF ):

Length:335

Mass:38,424

Sequence:MSSEVLPASIEPPNVEGKPGASDSEEERQKQRVDAEAQPISKRQLKKLMKQRLWEEQREQRKEKRKEKRKRKKLERRCQLESNSDGNDRKRIRRHVAPSNLRLIIDCSFDDLMVLKDIKKLHKQIQRCYAENRRASHPVQFYLTSHGGQLKKNMDENDQGWVNWKDIHIKSEHYSELIKKEDLVYLTSDSPNVLKDLDESKAYVIGGLVDHNHHKGLTFKQASSYGIKHAQLPLAEFVKMNSRKVLAVNHVFEIILEFLETGDWQEAFFTILPPRKGAVPAHKACESSPQDHQALPGGWDSAIEGEHGRDDPGSPHKEQQGQQSSSVSAVSPDPQ

Tissue specificity:Ubiquitously expressed. Is more abundant in brain and pancreatic islets compared to other tissues (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp