GRPE1_RAT P97576
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97576
Recommended name：GrpE protein homolog 1, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：79563
Gene names (primary )：Grpel1
Gene names (synonym )：Grepel1
Gene names (ORF )：
Length：217
Mass：24,297
Sequence：MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLEEDLGHCEPKTDPSSADKTLLEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEEVSNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA
Tissue specificity：Ubiquitous. Particularly abundant in heart, kidney and liver.
Induction：
Developmental stage：
Protein families：