GRPE1_RAT   P97576


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97576

Recommended name:GrpE protein homolog 1, mitochondrial

EC number:

Alternative names:

Cleaved into:

GeneID:79563

Gene names  (primary ):Grpel1

Gene names  (synonym ):Grepel1

Gene names  (ORF ):

Length:217

Mass:24,297

Sequence:MAARCVRLARRSLPALALSFRPSPRLLCTATKQKNNGQNLEEDLGHCEPKTDPSSADKTLLEEKVKLEEQLKETMEKYKRALADTENLRQRSQKLVEEAKLYGIQGFCKDLLEVADILEKATQSVPKEEVSNNNPHLKSLYEGLVMTEVQIQKVFTKHGLLRLDPIGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKDA

Tissue specificity:Ubiquitous. Particularly abundant in heart, kidney and liver.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp