TFF2_RAT Q09030
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q09030
Recommended name：Trefoil factor 2
EC number：
Alternative names：
Cleaved into：
GeneID：116592
Gene names (primary )：Tff2
Gene names (synonym )：Sml1
Gene names (ORF )：
Length：129
Mass：14,077
Sequence：MGPRGAPLLVVVLVLGLHALAEGEKPSPCRCSRMTPSNRKNCGFPGITSDQCFNLGCCFDSSVAGVPWCFHPLPNQASEQCVMEVSARENCGYPGISPEDCASRHCCFSNLIFEVPWCFFPQSVDDCHY
Tissue specificity：Expressed in the digestive tract, where it was found predominantly in the stomach with highest expression in the antrum. It is secreted predominantly from antral mucous cells into the lumen of the gastrointestinal tract.
Induction：
Developmental stage：
Protein families：