CF119_RAT B0BMZ6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B0BMZ6
Recommended name：Cilia- and flagella-associated protein 119 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：691909
Gene names (primary )：Cfap119
Gene names (synonym )：Ccdc189 Imported
Gene names (ORF )：
Length：332
Mass：37,860
Sequence：MITPRSSQSLEMKVQTELEHSPKLQEEPDRSPSLVDSSVIRIGTDEQNESPAEATSSPVEVAEDPGANLFPPPLPQPRICMWKYLDIHSMHRLEKAATVEEMREVLAELLELGGPEQSLRDAIILDLFSHALIFCRQQGFSLEQTSAACALLQDLHKACVATPLGNVEECYRYFTSVLFCHGVRRPPFSIDLFKEEQLLALADYVVNTYFRHFKLYKYVFTPQVRLDLSLSYMGLQSLHLWPEEKEDEEATVEQAATPQEEEPEAVTEAEQQPSEVCILQTYIKCQLNKELRQLQQLVEERLKESEERLSNRLAALERPYQTPPSKGKSKAK
Tissue specificity：Specifically expressed in testis (at protein level). 1
Induction：
Developmental stage：Expression is detected at 3 weeks of postnatal development and persists up to adulthood (PubMed:27032685). Expressed in elongated spermatids but not detected in spermatogonia, spermatocytes, and round spermatids (PubMed:27032685). 1
Protein families：