ZG16_RAT   Q8CJD3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CJD3

Recommended name:Zymogen granule membrane protein 16

EC number:

Alternative names:Secretory lectin ZG16

Cleaved into:

GeneID:171449

Gene names  (primary ):Zg16

Gene names  (synonym ):

Gene names  (ORF ):

Length:167

Mass:18,213

Sequence:MLAIALLVLLCASASANSIQSRSSSYSGEYGGKGGKRFSHSGNQLDGPITAIRIRVNRYYIIGLQVRYGTVWSDYVGGNQGDLEEIFLHPGESVIQVSGKYKSYVKQLIFVTDKGRYLPFGKDSGTSFNAVPLHPNTVLRFISGRSGSAIDAISLHWDTYPSHCNTC

Tissue specificity:Expressed in pancreas, colon, duodenum, and much less in stomach. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp