CKLF_RAT Q9JK79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK79
Recommended name：Chemokine-like factor
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cklf
Gene names (synonym )：Cklf1
Gene names (ORF )：
Length：151
Mass：16,855
Sequence：MDSPQKVVDHQPFCLSLKCFVKTLRLVVTVASMIFFIVAQAPEPYIVITGFEVTIILFLIALYMCSLDKTMRSFFWPLLDVINSVVTTLFMLIVSVSALIPETSTMIMVGGVFGFLTVICTVADCALMCQKLRFRPHGPYQNRSATDVDDS
Tissue specificity：Both isoforms have highest expression levels in testis with relatively lower expression level in liver, spleen, lung, brain and heart and barely detectable levels in skeletal muscle and kidney were barely detected. In most tissues, isoform CKLF2 has higher expression levels than isoform CKLF1. 1
Induction：
Developmental stage：
Protein families：