PDGFC_RAT Q9EQX6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9EQX6
Recommended name：Platelet-derived growth factor C
EC number：
Alternative names：Fallotein Spinal cord-derived growth factor (rScdfg) VEGF-E
Cleaved into：
GeneID：79429
Gene names (primary )：Pdgfc
Gene names (synonym )：Scdgf
Gene names (ORF )：
Length：345
Mass：38,734
Sequence：MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHSPKFPHTYPRNTVLVWRLVAVDENVRIQLTFDERFGLEDPEDDLCKYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSALSLDLLNNAVTAFSTVEELIRFLEPDRWQIDLDSLYKPTWPLLGKAFLYGKKSKAVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKIGVKGLHKSLTDVALEHHEECDCVCRGNTEG
Tissue specificity：Highly expressed in the kidney and adrenal gland. In the kidney, it is expressed in arteriolar smooth muscle cells and in epithelial cells of individual segments (at protein level). 2 s
Induction：Expressed in the floor plate of the spinal cord at 11 dpc and also in the ventricular zone at 16 dpc, but not in adult. In the brain, expression is more significant at 16 dpc than at adult, with high expression in the cortex, pontine area and choroid plexus. Detected in the otocyst at 16 dpc. 3 Publications
Developmental stage：Up-regulated in mesangial, visceral epithelial, and interstitial cells after predominant injury to these cells. Expression levels increase in hepatic cells undergoing in vitro transdifferentiation, which represents a model for hepatic fibrogenesis. Expression induced by indoxyl sulfate. Expression induced by angiotensin-2 via EGR1 in smooth muscle cells in neonatal but not in adult rats. 3 s
Protein families：