CBPQ_RAT   Q6IRK9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6IRK9

Recommended name:Carboxypeptidase Q

EC number:EC:3.4.17.-

Alternative names:Hematopoietic lineage switch 2 related protein (Hls2-rp) Liver annexin-like protein 1 (LAL-1) Plasma glutamate carboxypeptidase

Cleaved into:

GeneID:58952

Gene names  (primary ):Cpq

Gene names  (synonym ):Pgcp

Gene names  (ORF ):

Length:472

Mass:52,042

Sequence:MRFLFFLFVAVVHLFSLGSGKAIYKSGVSQRTFQEIKEEIANYEDVAKAIINLAVYGKYQNRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWERGEESAVMVVPRIHKLAILGLGGSIGTPPEGITAEVLVVASFVELQRRASEARGKIVVYNQPYTDYGKTVQYRERGAVEAAKVGAVASLIRSVASFSIYSPHTGHQGYQDGVPKIPTACITIEDAEMMSRMASRGDKIVIHLKMGAKTYPDTDSFNTVAEITGSKYPEEVVLVSGHLDSWDVGQGALDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGVGASQYYELHKANISKYSLVMEADSGTFLPTGLQFTGSDKARAIMKEVMSLLQPLNITKVFNDAEGTDINFWIQAGVPGASLRDDLYKYFFFHHSHGDTMTAMDPKQMNVAAAVWAVVAYVVADMEEMLPRS

Tissue specificity:During regeneration of liver. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp