NECA2_RAT F1LQY6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:F1LQY6
Recommended name：N-terminal EF-hand calcium-binding protein 2
EC number：
Alternative names：Neuronal calcium-binding protein 2
Cleaved into：
GeneID：170928
Gene names (primary )：Necab2
Gene names (synonym )：Efcbp2
Gene names (ORF )：
Length：389
Mass：43,526
Sequence：MCERAARLCRAGAHRLLREPPPQGRALGGLLRWVGARMGEPRAPLVPDIPAADPDPGPAAPRGGTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEGLFHTIDSDNTNHVDTKELCDYFVEHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGNNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQIRQDHCKPSPGVNESRYGGPTPPYIPNHKLVVPEPVKSLPVAIGEPKEEGLEVQISRLAELIGRLESKTLSFDLQQRLSDEEGTNMYLQLVRQEMAVCPEQLGEFLDSLRQYLRSTAEERNCFHVAAVRMADGLTFVIYEFWETEEEWKRHLQSPVCKAFRHVKVDTLSQPEALSQISVPAAWCTSGRD
Tissue specificity：Expressed in the striatum; predominantly in the caudate putamen. Expressed in hippocampus; particularly strong in the CA1 area. Expressed in the spinal dorsal horn with especially strong expression in lamina IIi; found in excitory synaptic boutons (at protein level). 3 s
Induction：
Developmental stage：
Protein families：