H31_RAT Q6LED0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6LED0
Recommended name:Histone H3.1
EC number:
Alternative names:
Cleaved into:
GeneID:291159
Gene names (primary ):UP000002494
Gene names (synonym ):Chromosome 17
Gene names (ORF ):
Length:136
Mass:15,404
Sequence:MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Tissue specificity:Expressed during S phase, then expression strongly decreases as cell division slows down during the process of differentiation.
Induction:
Developmental stage:
Protein families: