CPLX2_RAT P84087
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84087
Recommended name：Complexin-2
EC number：
Alternative names：
Cleaved into：
GeneID：116657
Gene names (primary )：Cplx2
Gene names (synonym )：
Gene names (ORF )：
Length：134
Mass：15,394
Sequence：MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK
Tissue specificity：Nervous system. Strongly expressed in brain, where it is predominant in neurons from cerebral cortex and hippocampus. Also present in mast cells (at protein level). 6 s
Induction：
Developmental stage：
Protein families：