U2D2B_RAT P70711
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70711
Recommended name：Ubiquitin-conjugating enzyme E2 D2B
EC number：EC:2.3.2.23
Alternative names：E2 ubiquitin-conjugating enzyme D2B Ubiquitin carrier protein D2B Ubiquitin-conjugating enzyme E2(17)KB 2B Ubiquitin-conjugating enzyme E2-17 kDa 2B Ubiquitin-protein ligase D2B
Cleaved into：
GeneID：79435
Gene names (primary )：Ube2d2b
Gene names (synonym )：Ube2d2
Gene names (ORF )：
Length：147
Mass：16,659
Sequence：MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWTQKYAM
Tissue specificity：Testis-specific. Mainly expressed in the round spermatids (at protein level). 1
Induction：
Developmental stage：
Protein families：