FGF2_RAT P13109
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P13109
Recommended name:Fibroblast growth factor 2
EC number:
Alternative names:Basic fibroblast growth factor (bFGF) Heparin-binding growth factor 2 (HBGF-2)
Cleaved into:
GeneID:54250
Gene names (primary ):Fgf2
Gene names (synonym ):Fgf-2
Gene names (ORF ):
Length:154
Mass:17,139
Sequence:MAAGSITSLPALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Tissue specificity:Found in all tissues examined.
Induction:
Developmental stage:
Protein families: