CYB5B_RAT P04166
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04166
Recommended name：Cytochrome b5 type B
EC number：
Alternative names：
Cleaved into：
GeneID：80773
Gene names (primary )：Cyb5b
Gene names (synonym )：Cyb5m, Omb5
Gene names (ORF )：
Length：146
Mass：16,265
Sequence：MATPEASGSGRNGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAILIGFLYRHFWADSKSS
Tissue specificity：
Induction：
Developmental stage：
Protein families：