VHLL_HUMAN   Q6RSH7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6RSH7

Recommended name:von Hippel-Lindau-like protein

EC number:

Alternative names:(VHL-like protein) (VLP)

Cleaved into:

GeneID:391104

Gene names  (primary ):VHLL

Gene names  (synonym ):VLP

Gene names  (ORF ):

Length:139

Mass:15781

Sequence:MPWRAGNGVGLEAQAGTQEAGPEEYCQEELGAEEEMAARAAWPVLRSVNSRELSRIIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVPSSNVNGQPVFANITLQCIP

Tissue specificity:Abundantly expressed in the placenta. {ECO:0000269|PubMed:14757845}.

Induction:

Developmental stage:

Protein families:VHL family


   💬 WhatsApp