SRA1_HUMAN Q9HD15
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9HD15
Recommended name：Steroid receptor RNA activator 1
EC number：
Alternative names：(Steroid receptor RNA activator protein) (SRAP)
Cleaved into：
GeneID：10011
Gene names (primary )：SRA1
Gene names (synonym )：
Gene names (ORF )：PP7684
Length：236
Mass：25673
Sequence：MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIHRSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS
Tissue specificity：Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up-regulated in human tumors of the breast, ovary, and uterus. {ECO:0000269|PubMed:10199399, ECO:0000269|PubMed:12565891, ECO:0000269|PubMed:14517287}.
Induction：
Developmental stage：
Protein families：SRA1 family