EMRE_HUMAN   Q9H4I9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H4I9

Recommended name:Essential MCU regulator, mitochondrial

EC number:

Alternative names:(Single-pass membrane protein with aspartate-rich tail 1, mitochondrial)

Cleaved into:

GeneID:91689

Gene names  (primary ):SMDT1

Gene names  (synonym ):C22orf32 EMRE

Gene names  (ORF ):

Length:107

Mass:11441

Sequence:MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD

Tissue specificity:

Induction:

Developmental stage:

Protein families:SMDT1/EMRE family


   💬 WhatsApp