REG3G_HUMAN Q6UW15
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UW15
Recommended name：Regenerating islet-derived protein 3-gamma
EC number：
Alternative names：(REG-3-gamma) (Pancreatitis-associated protein 1B) (PAP-1B) (Pancreatitis-associated protein IB) (PAP IB) (Regenerating islet-derived protein III-gamma) (REG III) (Reg III-gamma)
Cleaved into：Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form
GeneID：130120
Gene names (primary )：REG3G
Gene names (synonym )：PAP1B
Gene names (ORF )：UNQ429/PRO162
Length：175
Mass：19330
Sequence：MLPPMALPSVSWMLLSCLILLCQVQGEETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD
Tissue specificity：Predominantly expressed in pancreas, where it may be restricted to exocrine pancreas. Moderate expression levels in testis and weak in heart, kidney and placenta. {ECO:0000269|PubMed:15556304, ECO:0000269|PubMed:15777617}.
Induction：
Developmental stage：
Protein families：