LSM2_HUMAN   Q9Y333


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y333

Recommended name:U6 snRNA-associated Sm-like protein LSm2

EC number:

Alternative names:(Protein G7b) (Small nuclear ribonuclear protein D homolog) (snRNP core Sm-like protein Sm-x5)

Cleaved into:

GeneID:57819

Gene names  (primary ):LSM2

Gene names  (synonym ):C6orf28 G7B

Gene names  (ORF ):

Length:95

Mass:10835

Sequence:MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:SnRNP Sm proteins family


   💬 WhatsApp