NMES1_HUMAN Q9C002
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9C002
Recommended name：Normal mucosa of esophagus-specific gene 1 protein
EC number：
Alternative names：(Protein FOAP-11)
Cleaved into：
GeneID：84419
Gene names (primary )：NMES1
Gene names (synonym )：C15orf48
Gene names (ORF )：
Length：83
Mass：9617
Sequence：MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQRVTK
Tissue specificity：Expressed mainly in stomach, placenta, small intestine and colon, as well as in normal mucosa of esophagus. Down-regulated in esophageal squamous cell carcinoma.
Induction：
Developmental stage：
Protein families：Complex I NDUFA4 subunit family