PAQR3_HUMAN   Q6TCH7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6TCH7

Recommended name:Progestin and adipoQ receptor family member 3

EC number:

Alternative names:(Progestin and adipoQ receptor family member III) (Raf kinase trapping to Golgi) (RKTG)

Cleaved into:

GeneID:152559

Gene names  (primary ):PAQR3

Gene names  (synonym ):

Gene names  (ORF ):

Length:311

Mass:36217

Sequence:MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCIKSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCMLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRHSKPCPDYVSHL

Tissue specificity:Widely expressed in a range of tissues. {ECO:0000269|PubMed:16044242}.

Induction:

Developmental stage:

Protein families:ADIPOR family


   💬 WhatsApp