RT11_HUMAN P82912
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P82912
Recommended name：28S ribosomal protein S11, mitochondrial
EC number：
Alternative names：(MRP-S11) (S11mt) (Cervical cancer proto-oncogene 2 protein) (HCC-2) (Mitochondrial small ribosomal subunit protein uS11m)
Cleaved into：
GeneID：64963
Gene names (primary )：MRPS11
Gene names (synonym )：RPMS11
Gene names (ORF )：HCC2
Length：194
Mass：20616
Sequence：MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Universal ribosomal protein uS11 family