MB3L2_HUMAN   Q8NHZ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8NHZ7

Recommended name:Methyl-CpG-binding domain protein 3-like 2

EC number:

Alternative names:(MBD3-like protein 2)

Cleaved into:

GeneID:125997

Gene names  (primary ):MBD3L2

Gene names  (synonym ):

Gene names  (ORF ):

Length:208

Mass:22994

Sequence:MGEPAFTSFPSLPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRSPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARRAEMLTGG

Tissue specificity:Detected at low levels in several somatic tissues. Highly expressed in the ovarian teratocarcinoma cell line PA-1. {ECO:0000269|PubMed:12504854}.

Induction:

Developmental stage:

Protein families:MBD3L family


   💬 WhatsApp