SG2A2_HUMAN Q13296
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13296
Recommended name：Mammaglobin-A
EC number：
Alternative names：(Mammaglobin-1) (Secretoglobin family 2A member 2)
Cleaved into：
GeneID：4250
Gene names (primary )：SCGB2A2
Gene names (synonym )：MGB1 UGB2
Gene names (ORF )：
Length：93
Mass：10499
Sequence：MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Tissue specificity：Mammary gland specific. Over-expressed in breast cancer.
Induction：
Developmental stage：
Protein families：Secretoglobin family, Lipophilin subfamily