KRA46_HUMAN   Q9BYQ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BYQ5

Recommended name:Keratin-associated protein 4-6

EC number:

Alternative names:(Keratin-associated protein 4-15) (Keratin-associated protein 4.15) (Keratin-associated protein 4.6) (Ultrahigh sulfur keratin-associated protein 4.15)

Cleaved into:

GeneID:81871

Gene names  (primary ):KRTAP4-6

Gene names  (synonym ):KAP4.15 KRTAP4-15 KRTAP4.15 KRTAP4.6

Gene names  (ORF ):

Length:205

Mass:21825

Sequence:MVSSCCGSVCSDQGCGLETCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCSISSCCRPSCCVSRCCRSQCCQSVCCQPTCCRPSCCISSCCRPSCCESSCCRPCCCRPCCCLRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC

Tissue specificity:Expressed in the hair follicles. {ECO:0000269|PubMed:15955084}.

Induction:

Developmental stage:

Protein families:KRTAP type 4 family


   💬 WhatsApp